DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and Cnn1

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_011240690.2 Gene:Cnn1 / 12797 MGIID:104979 Length:306 Species:Mus musculus


Alignment Length:181 Identity:72/181 - (39%)
Similarity:107/181 - (59%) Gaps:9/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVN 67
            |...|:.|:|.|.:.:.::|.:||||.:...:.  |.::.|.||||.:||:.||.|.|.:|.|||
Mouse    63 LSAEVKNKLAQKYDHQREQELREWIEGVTGRRI--GNNFMDGLKDGIILCEFINKLQPGSVKKVN 125

  Fly    68 SSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKG-- 130
            .|...:..:|||.||.||:.:|||...|:|:..||:|..:...|.:|:.||.    ..|..||  
Mouse   126 ESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALA----SMAKTKGNK 186

  Fly   131 PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNL-GAGRKI 180
            ..:|.|.|::.:|.|..|:|:.|:.|:|||.|:||||:|||... |..|:|
Mouse   187 VNVGVKYAEKQERRFEPEKLREGRNIIGLQMGTNKGASQAGMTAPGTKRQI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 69/174 (40%)
CH 18..121 CDD:237981 41/102 (40%)
Calponin 158..178 CDD:278814 12/20 (60%)
Cnn1XP_011240690.2 CH_CNN1 76..183 CDD:409131 42/112 (38%)
Calponin 213..237 CDD:395325 13/23 (57%)
Calponin 253..276 CDD:395325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834940
Domainoid 1 1.000 89 1.000 Domainoid score I7812
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.