DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and CNN2

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001290430.1 Gene:CNN2 / 1265 HGNCID:2156 Length:330 Species:Homo sapiens


Alignment Length:200 Identity:64/200 - (32%)
Similarity:108/200 - (54%) Gaps:23/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVN 67
            |...|:.::.||.:|:.:.|.:.|||.:..  ...|..::..||||.:||.|:|.|.|.:|||:|
Human    14 LSAEVKNRLLSKYDPQKEAELRTWIEGLTG--LSIGPDFQKGLKDGTILCTLMNKLQPGSVPKIN 76

  Fly    68 SSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFAL-GRA---------- 121
            .|...:..:||::||.||:..||:..:|:|:..||:|..::..|..::.|| |:.          
Human    77 RSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKGLDLGSLAALC 141

  Fly   122 ------TYKHADFK----GPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGA 176
                  :...|..|    |..:|.|.:::.:|:|.:..:||||.::|||.|:||.|:|:|.....
Human   142 WYSRPLSLTQAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYG 206

  Fly   177 GRKIL 181
            .|:.|
Human   207 TRRHL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 61/192 (32%)
CH 18..121 CDD:237981 37/103 (36%)
Calponin 158..178 CDD:278814 9/19 (47%)
CNN2NP_001290430.1 Calponin 19..211 CDD:332521 61/193 (32%)
Calponin 227..250 CDD:306832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144830
Domainoid 1 1.000 89 1.000 Domainoid score I7831
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3215
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.