Sequence 1: | NP_001014522.2 | Gene: | Mp20 / 36468 | FlyBaseID: | FBgn0002789 | Length: | 189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001290430.1 | Gene: | CNN2 / 1265 | HGNCID: | 2156 | Length: | 330 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 64/200 - (32%) |
---|---|---|---|
Similarity: | 108/200 - (54%) | Gaps: | 23/200 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVN 67
Fly 68 SSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFAL-GRA---------- 121
Fly 122 ------TYKHADFK----GPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGA 176
Fly 177 GRKIL 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mp20 | NP_001014522.2 | SCP1 | 7..179 | CDD:227526 | 61/192 (32%) |
CH | 18..121 | CDD:237981 | 37/103 (36%) | ||
Calponin | 158..178 | CDD:278814 | 9/19 (47%) | ||
CNN2 | NP_001290430.1 | Calponin | 19..211 | CDD:332521 | 61/193 (32%) |
Calponin | 227..250 | CDD:306832 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165144830 | |
Domainoid | 1 | 1.000 | 89 | 1.000 | Domainoid score | I7831 |
eggNOG | 1 | 0.900 | - | - | E1_COG5199 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 1 | 1.000 | - | - | H3215 | |
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D488325at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000270 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2278 |
SonicParanoid | 1 | 1.000 | - | - | X194 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.780 |