DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and EEF1E1

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_004271.1 Gene:EEF1E1 / 9521 HGNCID:3212 Length:174 Species:Homo sapiens


Alignment Length:75 Identity:17/75 - (22%)
Similarity:31/75 - (41%) Gaps:13/75 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 MERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQ---FPRLRRWFTAMQQLDAYEANCSGL 205
            :..|||:..::.|...||||:.:...|....:...:.:   :..:.|||..:|....        
Human    98 LNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPG-------- 154

  Fly   206 EKLRQTMESV 215
              :||.:.||
Human   155 --IRQHLSSV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 13/58 (22%)
GST_N_Delta_Epsilon 6..79 CDD:239343
GST_C_Delta_Epsilon 94..209 CDD:198287 13/67 (19%)
EEF1E1NP_004271.1 N-terminal 2..56
Linker 57..63
C-terminal 64..152 13/53 (25%)
GST_C_AIMP3 65..165 CDD:198338 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.