DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTO1

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:202 Identity:43/202 - (21%)
Similarity:77/202 - (38%) Gaps:20/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PKPI------LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVH 62
            |.|:      :|.....|......:::|...|..|:..:||....::   |...||...||.|.:
Human    16 PGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEW---FFKKNPFGLVPVLEN 77

  Fly    63 GDLVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFAN 127
            ....|....||.....::...|..|.|.:..|  |....::.|   ||.:....:.:.:|.. ..
Human    78 SQGQLIYESAITCEYLDEAYPGKKLLPDDPYE--KACQKMILE---LFSKVPSLVGSFIRSQ-NK 136

  Fly   128 VDVAHHERKLTEAYIIMERYLEN--SDFMAGPQLTLADLSI---VTTLSTVNLMFPLSQFPRLRR 187
            .|.|..:.:..:.:..:|..|.|  :.|..|..:::.|..|   ...|..:.|...:...|:|:.
Human   137 EDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKL 201

  Fly   188 WFTAMQQ 194
            |..||::
Human   202 WMAAMKE 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 42/200 (21%)
GST_N_Delta_Epsilon 6..79 CDD:239343 17/78 (22%)
GST_C_Delta_Epsilon 94..209 CDD:198287 22/106 (21%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 18/80 (23%)