Sequence 1: | NP_610855.1 | Gene: | GstE14 / 36467 | FlyBaseID: | FBgn0033817 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015277.1 | Gene: | CAM1 / 856059 | SGDID: | S000005969 | Length: | 415 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 202 | Identity: | 47/202 - (23%) |
---|---|---|---|
Similarity: | 82/202 - (40%) | Gaps: | 56/202 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 LIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLV-HGDLVLTDSHAILIHLAEKFDEGGS 86
Fly 87 LWPQEHAERMKVLNLLLFECSFLFRRDSDF--MSATVR-QGFANVDV--------------AHHE 134
Fly 135 RKLTEAYI--------IMERYLENSDFMAGPQLTLADLSIVTTLST--VNLMFPL---SQFPRLR 186
Fly 187 RWFTAMQ 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE14 | NP_610855.1 | GstA | 6..200 | CDD:223698 | 47/202 (23%) |
GST_N_Delta_Epsilon | 6..79 | CDD:239343 | 19/56 (34%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 28/130 (22%) | ||
CAM1 | NP_015277.1 | GST_N_EF1Bgamma | 4..73 | CDD:239342 | 19/57 (33%) |
GST_C_EF1Bgamma_like | 92..214 | CDD:198290 | 23/106 (22%) | ||
EF1G | 255..359 | CDD:395522 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |