DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GTT1

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:51/253 - (20%)
Similarity:99/253 - (39%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPKPILYYDERSPPVRSCLMLIKLLD-IDVELRFVNLFKGEQFQ--KDFLALNPQHSVPTLVH 62
            ||.|...:::.:.|...|    |:.||| :::|...|...:...|:  .:...::|....|.|..
Yeast     1 MSLPIIKVHWLDHSRAFR----LLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEV 61

  Fly    63 GD------LVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLF--ECSFLFRRDSDFMSA 119
            .|      .:|.:|..|..::.:.||....|. .|.|:....:|..||  |.|.......:|:.:
Yeast    62 QDRETGKKKILAESGFIFQYVLQHFDHSHVLM-SEDADIADQINYYLFYVEGSLQPPLMIEFILS 125

  Fly   120 TVRQGFANVDVAHHER----KLTEAY----------IIMERYLENSDFMAGPQLTLADLSIVTTL 170
            .|:.......:::..|    |:::||          .:.....:|:.::...:|:.||       
Yeast   126 KVKDSGMPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGAD------- 183

  Fly   171 STVNLMFPL-----------SQFPRLRRWFTAMQQLDAYEANCSGLEKLRQTMESVGS 217
              :.:.|||           ..:|.:.:|...:...::|.|:   .||.|    ::||
Yeast   184 --ILMSFPLQMAFERKFAAPEDYPAISKWLKTITSEESYAAS---KEKAR----ALGS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 42/229 (18%)
GST_N_Delta_Epsilon 6..79 CDD:239343 16/81 (20%)
GST_C_Delta_Epsilon 94..209 CDD:198287 24/141 (17%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 16/84 (19%)
GST_C_GTT1_like 93..218 CDD:198298 22/134 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.