DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and YGR201C

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:54/231 - (23%)
Similarity:89/231 - (38%) Gaps:68/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIKLLDIDVELRFVNLFKGEQ-FQKDFLALNPQHSVPTLV--HGDLVLTDSHAI---LIHLAEKF 81
            |::.|.:||:|  .:....:| ::::|    |....||.|  |.:..||::.||   ||||:   
Yeast    24 LVRSLKLDVKL--ADPSDAQQLYEREF----PLRKYPTFVGPHDEWTLTEAMAIDYYLIHLS--- 79

  Fly    82 DEGGSLWPQEHAERMKVLNLLLFECSFLFRRD---------SDFMSATVRQGF------------ 125
                       :::..|..||..|..|..|.|         |||::......|            
Yeast    80 -----------SDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGVKPYNATE 133

  Fly   126 -----ANVD--VAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMF----PL 179
                 .|||  |:.:|::|.:     ::||...|     ..|||||......|...:.|    ..
Yeast   134 FKAARENVDTIVSLYEKRLKK-----QQYLVCDD-----HETLADLISAAAFSLGFISFFDETWR 188

  Fly   180 SQFPRLRRWFTAMQQLDAYEANCSGLEKLRQTMESV 215
            |:.|.:.|||..:.:...:|......:.....|:.:
Yeast   189 SKHPEVTRWFNRVIKSRFFEGEFESFKMCETEMQPI 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 52/214 (24%)
GST_N_Delta_Epsilon 6..79 CDD:239343 20/61 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 33/146 (23%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 18/59 (31%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 28/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.