DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GTT2

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:49/203 - (24%)
Similarity:85/203 - (41%) Gaps:18/203 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILYYDERSPP----VRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVL 67
            ::.||..:.|    ||..|....:|. .|:...:||:|||..:.:|||.|...:||.|...|..|
Yeast    19 MIIYDTPAGPYPARVRIALAEKNMLS-SVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTL 82

  Fly    68 TDSHAILIHLAEKFDEGGSLWPQEHAER--MKVLNL-----LLFECSFLFRRDSDFMSATVRQGF 125
            ......:....:..|...:|..:...|:  :.::|.     ||...|..|...:..:...| :.:
Yeast    83 IAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPGLGPEV-ELY 146

  Fly   126 ANVDVAHHER-KLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTL---STVNLMFPLSQFPRLR 186
            .|.:....:| |........:..|....::||...::||::::..|   :.|.|..| .:...||
Yeast   147 QNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAIVKLQVP-EECEALR 210

  Fly   187 RWFTAMQQ 194
            .|:..|||
Yeast   211 AWYKRMQQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 49/203 (24%)
GST_N_Delta_Epsilon 6..79 CDD:239343 22/75 (29%)
GST_C_Delta_Epsilon 94..209 CDD:198287 25/112 (22%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 22/75 (29%)
GST_C_GTT2_like 106..222 CDD:198291 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.