DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTF7

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:196 Identity:48/196 - (24%)
Similarity:78/196 - (39%) Gaps:33/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAILIHLA 78
            |...|..|:.:...::|.|...:.|..||..::.|:..||...||....||..|.:|.||..::|
plant    12 STATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQYIA 76

  Fly    79 EKFDEGG----SLWPQEHA-----------ERMKVLNLLLFE--CSFLFRRDSDFMSATVRQGFA 126
            ..:.:.|    ||..::.|           |...|.:.|::|  ...|:...:|   .||     
plant    77 HFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTD---KTV----- 133

  Fly   127 NVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQF----PRLRR 187
               |...|.||.:...:.|..|..|.::|..:.||.||..:..:..: |..|..:.    |.:..
plant   134 ---VEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYL-LGTPTKKLFDERPHVSA 194

  Fly   188 W 188
            |
plant   195 W 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 48/196 (24%)
GST_N_Delta_Epsilon 6..79 CDD:239343 19/64 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 24/101 (24%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 19/64 (30%)
GST_C_Phi 95..209 CDD:198296 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.