DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTF4

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:206 Identity:52/206 - (25%)
Similarity:82/206 - (39%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAILI 75
            |..|...|..|.::....:..|...|.|..||...:.||:|||...||....|.:.|.:|.||..
plant    42 DPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQ 106

  Fly    76 HLAEKFDEGGS--LWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANV--------DV 130
            ::|......|:  |..:.| |.|..|.:.:...:..|  |......|..|....:        .|
plant   107 YIAYVHSSRGTQLLNLRSH-ETMATLTMWMEIEAHQF--DPPASKLTWEQVIKPIYGLETDQTIV 168

  Fly   131 AHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQF----PRLRRWFTA 191
            ..:|..|.:...|.|:.||.|.|:|....||.||..:..:..: |..|..:.    .::|:|...
plant   169 KENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYL-LGTPTKKLFEKRSKVRKWVDE 232

  Fly   192 MQQLDAYEANC 202
            :...:|::..|
plant   233 ITSREAWKMAC 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 51/202 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 21/67 (31%)
GST_C_Delta_Epsilon 94..209 CDD:198287 27/121 (22%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 21/66 (32%)
GST_C_Phi 126..243 CDD:198296 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.