DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTF12

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:188 Identity:44/188 - (23%)
Similarity:76/188 - (40%) Gaps:44/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAILIHLAEKF-DEGGSL----- 87
            |:.|:..::|...||.:.:.|...|...||.:..||..|.:|.||..:.|.|| |:|.:|     
plant    26 IEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFADQGTNLLGKSL 90

  Fly    88 --------WPQEHAERMKVL------NLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHERKLT 138
                    |.........||      ||::                ..|.| ...||...|....
plant    91 EHRAIVDQWADVETYYFNVLAQPLVINLII----------------KPRLG-EKCDVVLVEDLKV 138

  Fly   139 EAYIIMERY---LENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQFPRLR----RWF 189
            :..::::.|   |.::.|:||.:.|:|||:.:..:..:..:..::|..:.|    ||:
plant   139 KLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMVKARGSFNRWW 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 44/188 (23%)
GST_N_Delta_Epsilon 6..79 CDD:239343 15/49 (31%)
GST_C_Delta_Epsilon 94..209 CDD:198287 22/109 (20%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 44/188 (23%)
GST_N_Phi 2..77 CDD:239351 16/50 (32%)
GST_C_Phi 91..209 CDD:198296 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.