DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTF2

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:200 Identity:48/200 - (24%)
Similarity:81/200 - (40%) Gaps:24/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAILIHLAEKFD 82
            |..|:.:...::|.||..|.|..||..::.||:.||...||....|||.|.:|.||..::|.:::
plant    16 RRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYE 80

  Fly    83 EGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANV------------DVAHHER 135
            ..|:...|..::.:....::......   .|..|.....:..|..:            .||..|.
plant    81 NQGTNLLQTDSKNISQYAIMAIGMQV---EDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEA 142

  Fly   136 KLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLS------TVNLMFPLSQFPRLRRWFTAMQQ 194
            ||.:...:.|..|:...::||...||.||..:..:.      |..|   .::.||:..|...:.:
plant   143 KLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKL---FTERPRVNEWVAEITK 204

  Fly   195 LDAYE 199
            ..|.|
plant   205 RPASE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 47/199 (24%)
GST_N_Delta_Epsilon 6..79 CDD:239343 22/60 (37%)
GST_C_Delta_Epsilon 94..209 CDD:198287 22/123 (18%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 23/61 (38%)
GST_C_Phi 96..211 CDD:198296 22/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.