DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:218 Identity:54/218 - (24%)
Similarity:91/218 - (41%) Gaps:30/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72
            ||.||.|..|...|:.:...:.:.||..||||........||::||...||.|...||.|.:|.|
plant     5 LYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRA 69

  Fly    73 ILIHLAEKFDEGGS---------------LWPQEHAERMK-VLNLLLFECSFLFRRDSDFMSATV 121
            |..::|||..:.|:               ||.:..|.... .::.::.:...:..:.....:|.|
plant    70 ITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLIVVPLQGESPNAAIV 134

  Fly   122 RQGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVT----TLSTVNLMFPLSQF 182
            .:...|:.      |:.:.|   |..|..:.::||...|||||..|.    .:.|::... ::..
plant   135 EENLENLG------KILDVY---EERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHAGL-INDR 189

  Fly   183 PRLRRWFTAMQQLDAYEANCSGL 205
            |.::.|:..:....|:.....||
plant   190 PNVKAWWEDLCSRPAFLKVSPGL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 52/211 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 26/70 (37%)
GST_C_Delta_Epsilon 94..209 CDD:198287 21/117 (18%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 52/213 (24%)
GST_N_Phi 2..77 CDD:239351 27/71 (38%)
GST_C_Phi 92..208 CDD:198296 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.