DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTF11

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:207 Identity:53/207 - (25%)
Similarity:84/207 - (40%) Gaps:37/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAILIHLAEK 80
            |.|..|..:: .||:.|:..|:|.|.||.:...|...|...||.:..|.|.|.:|.||..:.|.|
plant    14 PQRVLLCFLE-KDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATK 77

  Fly    81 F-DEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANV----------DVAHHE 134
            : |:|..|..:....|..|...:..|.::.:        |.......||          |||..|
plant    78 YADQGTDLLGKTLEGRAIVDQWVEVENNYFY--------AVALPLVMNVVFKPKSGKPCDVALVE 134

  Fly   135 R---KLTEAYIIMERYLENSDFMAGPQLTLADLSIV---------TTLSTVNLMFPLSQFPRLRR 187
            .   |..:...:.|..|..:.::.|.:.||||||.:         |:||.:     ::....|.|
plant   135 ELKVKFDKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGL-----VTSRENLNR 194

  Fly   188 WFTAMQQLDAYE 199
            |:..:....|::
plant   195 WWNEISARPAWK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 53/207 (26%)
GST_N_Delta_Epsilon 6..79 CDD:239343 21/62 (34%)
GST_C_Delta_Epsilon 94..209 CDD:198287 27/128 (21%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 53/207 (26%)
GST_N_Phi 2..77 CDD:239351 22/63 (35%)
GST_C_Phi 91..209 CDD:198296 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.