DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTF8

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:202 Identity:58/202 - (28%)
Similarity:88/202 - (43%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAILIHLAEKFDEGG------- 85
            |:..||..|::..|...|:..|||||...:|.|..|||.|.:|.||..:|||::.|.|       
plant    74 DLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQYLAEEYSEKGEKLISQD 138

  Fly    86 --------SLWPQEHAERMKV-LNLLLFECSF--LFRRDSDFMSATVRQGFANVDVAHHERKLTE 139
                    ::|.|...::... .:.|.||..|  :|...:|  .|.|::         .|.||.:
plant   139 CKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTD--PAAVQE---------LEGKLQK 192

  Fly   140 AYIIMERYLENSDFMAGPQLTLADL----SIVTTLSTVNLMFPLSQFPRLRRWFTAMQQLDAYEA 200
            ...:.|..|..|:|:||...|||||    :|...|.|.:.:. ....|::..|...:....|: |
plant   193 VLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVL-FDSRPKVSEWIKKISARPAW-A 255

  Fly   201 NCSGLEK 207
            ....|:|
plant   256 KVIDLQK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 55/193 (28%)
GST_N_Delta_Epsilon 6..79 CDD:239343 21/50 (42%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/121 (26%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.