DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTF10

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:154 Identity:46/154 - (29%)
Similarity:77/154 - (50%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIKLLDIDVELRFVN--LFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAILIHLAEKF-DEG 84
            ::.|::..|....||  |.||||.|.::||:.|...:|.||.||..:.:|.||:.::|||: .:|
plant    17 VVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQG 81

  Fly    85 GSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANV--------DVAHHERKLTEAY 141
            ..|..:...||.:|...|..|.:   ......::.|:...||.:        .:...|.||.|..
plant    82 PDLLGKTIEERGQVEQWLDVEAT---SYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVL 143

  Fly   142 IIMERYLENSDFMAGPQLTLADLS 165
            .:.|..|..::::||..::||||:
plant   144 DVYEAQLSKNEYLAGDFVSLADLA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 46/154 (30%)
GST_N_Delta_Epsilon 6..79 CDD:239343 21/57 (37%)
GST_C_Delta_Epsilon 94..209 CDD:198287 20/80 (25%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 46/154 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.