DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and Gstt4

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:191 Identity:44/191 - (23%)
Similarity:86/191 - (45%) Gaps:36/191 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72
            ||.|..|.|.|:..:..:...|..:.:||:|.||....|:::.:||...||:|..|..:|::|.|
  Rat     5 LYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDGKFILSESVA 69

  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFE--------CSFLFRR-----------DSDFMS 118
            ||.:|..|:......:|.:...|.:|...:.::        ...|:.:           .::.:.
  Rat    70 ILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTERLD 134

  Fly   119 ATVRQGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL 179
            .|:.:  .|.::...|          |::|::..|:.|..::||||     ::.|.:|.|:
  Rat   135 KTLDE--VNKNIKQFE----------EKFLQDKLFITGDHISLADL-----VALVEMMQPM 178

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 44/191 (23%)
GST_N_Delta_Epsilon 6..79 CDD:239343 25/70 (36%)
GST_C_Delta_Epsilon 94..209 CDD:198287 17/105 (16%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 25/72 (35%)