DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and Eef1g

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_080283.3 Gene:Eef1g / 67160 MGIID:1914410 Length:437 Species:Mus musculus


Alignment Length:191 Identity:46/191 - (24%)
Similarity:82/191 - (42%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DFLALNPQHSVPTLVHGD--LVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFL 109
            :||...|...||.. .||  ..:.:|:||..:::.:...|.:  |:..|:   |:..:.|     
Mouse    48 EFLRKFPAGKVPAF-EGDDGFCVFESNAIAYYVSNEELRGST--PEAAAQ---VVQWVSF----- 101

  Fly   110 FRRDSDFMSATVRQGFANVDVAHHERKLTE--------AYIIMERYLENSDFMAGPQLTLADLSI 166
              .|||.:.......|..:.:.||.::.||        ...:::.:|:...|:.|.::||||:::
Mouse   102 --ADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITV 164

  Fly   167 VTTLSTV--NLMFP--LSQFPRLRRWFTAMQQLDAYEANCSGLEKLRQTMESVGSFQFPSS 223
            |.||..:  .::.|  ...||...|||........:.| ..|..||.:.|....:.:|..|
Mouse   165 VCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRA-ILGEVKLCEKMAQFDAKKFAES 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 39/166 (23%)
GST_N_Delta_Epsilon 6..79 CDD:239343 10/33 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 29/126 (23%)
Eef1gNP_080283.3 GST_N_EF1Bgamma 4..82 CDD:239342 10/34 (29%)
GstA 5..202 CDD:223698 39/166 (23%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/132 (23%)
FinO_conjug_rep <211..>265 CDD:301594 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 2/4 (50%)
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.