DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and gstr

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:217 Identity:56/217 - (25%)
Similarity:96/217 - (44%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILYYDERSPPVRSCLMLI-------------KLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVP 58
            :||:...|||   |..|:             |||..|         |.|....:..||||:..:|
Zfish     6 LLYWGTGSPP---CWRLMIALEEKQLQGYKHKLLSFD---------KKEHQSPEVKALNPRAQLP 58

  Fly    59 TLVHGDLVLTDSHAILIHLAEKF-DEGGSLWPQEHAERMKVLNLLLFECSFLFRR--DSDFMSAT 120
            |..||::|:.:|.|..::|...| .:|..|.|...|| |.::...:||...|.::  :..|....
Zfish    59 TFKHGEIVVNESFAACLYLESVFKSQGTRLIPDNPAE-MALVYQRMFETENLQQKMYEVAFYDWL 122

  Fly   121 VRQGFANVDVA--HHERKLTEAYIIMERYLE---NSDFMAGPQLTLADLSIVTTLSTV-NLMFPL 179
            |.:| ..::.|  .::.||.|...:.|.|||   ...::||...::||:.....::.. .|..|.
Zfish   123 VPEG-ERLESALKRNKEKLIEELKLWEGYLEKMGKGSYLAGKNFSMADVVCFPVIAYFPRLQCPK 186

  Fly   180 SQFPRLRRWFTAMQQLDAYEAN 201
            .:.|||..::..::...:.:|:
Zfish   187 ERCPRLMEYYEMVKDRPSIKAS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 55/214 (26%)
GST_N_Delta_Epsilon 6..79 CDD:239343 25/84 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/116 (22%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 55/214 (26%)
GST_N_family 5..78 CDD:238319 24/83 (29%)
GST_C_family 99..199 CDD:198286 23/100 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.