DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and gstt1a

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:235 Identity:61/235 - (25%)
Similarity:103/235 - (43%) Gaps:29/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72
            ||.|..|.|.||..:..|:..|..|.:.|:|..|||:..:|..::....||.|..||.:||:|.|
Zfish     5 LYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTESIA 69

  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSD-FMSATVRQGFANVDVAHHERK 136
            ||::||.|.......:|.:..:|.:|...|.::.:.:....|. |....|........|.  :.|
Zfish    70 ILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKVFWFKGVLPAVTGAPVP--KEK 132

  Fly   137 LTEAY--------IIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQ-------FPRLR 186
            :..|.        |..:::|::..|:.|.:::|||:     ::.|.:|.|::.       .|.|.
Zfish   133 MDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADI-----VAIVEMMQPVATGVDVFEGRPALS 192

  Fly   187 RW------FTAMQQLDAYEANCSGLEKLRQTMESVGSFQF 220
            .|      ...::..|........:|.|.||.|:.|..:|
Zfish   193 AWRDRVKKEVGVELFDEAHKVIMNVESLPQTFENKGLPEF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 54/213 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 28/70 (40%)
GST_C_Delta_Epsilon 94..209 CDD:198287 24/136 (18%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 53/200 (27%)
GST_N_Theta 3..78 CDD:239348 29/72 (40%)
GST_C_Theta 91..217 CDD:198292 23/132 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.