DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and Gstt3

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:268 Identity:67/268 - (25%)
Similarity:107/268 - (39%) Gaps:81/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PKPI-----------------LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLAL 51
            |:||                 ||.|..|.|.|:..:..|...|..:||.:.|.||:.:...|..:
  Rat    41 PRPISEVCQRLLPTASAMGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQV 105

  Fly    52 NPQHSVPTLVHGDLVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFE-------CSFL 109
            ||...||.|..||.||.:|.|||::|:.|:......:||:...|.:|...|.::       ||..
  Rat   106 NPLRKVPALKDGDFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRA 170

  Fly   110 FRRDSDF------------MSATVRQGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLA 162
            ..:...|            :::|:    |.:|..        ..::.:::|:|..|:.||.:::|
  Rat   171 MWQKMMFPVFLGQPVPPERLASTL----AELDGC--------LQMLEDKFLQNKAFLTGPHISVA 223

  Fly   163 DLSIVTTLSTVNLMFPLS-------QFPRLRRWFTAMQQLDAYEANCSGLEKLRQTME-SVGSFQ 219
            ||..:|     .||.|:|       ..|:|..|                    ||.:| :||...
  Rat   224 DLVAIT-----ELMHPVSAGCKIFESRPKLAAW--------------------RQRVEAAVGESL 263

  Fly   220 FPSSSAVV 227
            |..:..||
  Rat   264 FQEAHEVV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 58/236 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 30/89 (34%)
GST_C_Delta_Epsilon 94..209 CDD:198287 25/140 (18%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 28/74 (38%)
GST_C_Theta 149..273 CDD:198292 33/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.