DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:219 Identity:54/219 - (24%)
Similarity:95/219 - (43%) Gaps:23/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPKPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFK-GEQFQKDFLALNPQHSVPTLVHGD 64
            ||..:..||.|..|.|.||..:..|...|......:.|.| ||...::|..::..|.||.|..|:
 Frog     1 MSSSELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGN 65

  Fly    65 LVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSD-FMSATVRQGFANV 128
            ..:.:|.|:|::||.|:......:|.:..:|.:|...|.::.:......|. |.:..|.......
 Frog    66 FTMAESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTILGK 130

  Fly   129 DVAHHERKLTEAYIIM------ERYLENSDFMAGPQLTLADLSIVTTL-----STVNLMFPLSQF 182
            :|...:.....|..:.      |::|.|..|:||.::::|||..:..:     |.||:   ..:.
 Frog   131 EVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNV---FEER 192

  Fly   183 PRLRRWFTAMQQ-------LDAYE 199
            |:|..|...:.:       |:|:|
 Frog   193 PKLGSWKQRLVEAVGEELFLEAHE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 52/214 (24%)
GST_N_Delta_Epsilon 6..79 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/125 (21%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 24/75 (32%)
GST_C_Theta 95..221 CDD:198292 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.