DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstD7

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:211 Identity:69/211 - (32%)
Similarity:115/211 - (54%) Gaps:10/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PKPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLT 68
            |...||....:|..|:..|:.|.|.:::..:.:|..:|:|.:.:|:.:||||::||||....|:.
  Fly     2 PNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIW 66

  Fly    69 DSHAILIHLAEKFDEGGS-LWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQG-FANVDVA 131
            :|.||.::|.||:.:..| |:|.:..:|..:...|.|:...|:...:.:.....|.| |.:.:..
  Fly    67 ESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEAL 131

  Fly   132 HHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVN-LMFPLSQFPRLRRWF-TAMQQ 194
            .   |:..|:..:..:||..||:||.|||:||:.|:.|:|||. ..|.||:||.:.||. .|.:.
  Fly   132 D---KVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKV 193

  Fly   195 LDAYEANCSGLEKLRQ 210
            ...:|.|   ||.|:|
  Fly   194 TPGWEQN---LESLQQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 62/197 (31%)
GST_N_Delta_Epsilon 6..79 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 37/117 (32%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GstA 6..188 CDD:223698 61/184 (33%)
GST_C_Delta_Epsilon 92..206 CDD:198287 38/119 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.