DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstD6

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:205 Identity:58/205 - (28%)
Similarity:115/205 - (56%) Gaps:4/205 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72
            ||....||..|:.:|..|.:.::.....||.|.|||.:..|:.:||||::||||....|:.::.|
  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67

  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHERKL 137
            |:::|.|::.:..||:|::..::..:...|.|:...|:...:.:....:|.|  ......:..||
  Fly    68 IVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTG--KPGTQENLEKL 130

  Fly   138 TEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWFTAMQQL-DAYEA 200
            ..|:.::..:|:..|::||.||::||:.|:.|:||..:: |.|.:||.:.||:...|:: ..::.
  Fly   131 NAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFPNVDRWYKNAQKVTPGWDE 195

  Fly   201 NCSGLEKLRQ 210
            |.:.::..::
  Fly   196 NLARIQSAKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 57/193 (30%)
GST_N_Delta_Epsilon 6..79 CDD:239343 26/70 (37%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/116 (24%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 26/70 (37%)
PLN02395 11..208 CDD:166036 54/197 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.