DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstD5

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:208 Identity:56/208 - (26%)
Similarity:114/208 - (54%) Gaps:4/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAI 73
            ||..|....|:.:|:.|.|.:.:.::.:|..:.:|.:.:|:.|||||::||||.....:.:|.||
  Fly     4 YYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68

  Fly    74 LIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHERKLT 138
            .::|.||:.:..:|:|::..::..|...|.|:...|:...:.:.......|....|  ...:|:.
  Fly    69 AVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSD--EDFKKIE 131

  Fly   139 EAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWF-TAMQQLDAYEAN 201
            .::..:..:||..:::||..||:||::|::|:||..:. |.|:::|.:.||: .|.:....:|.|
  Fly   132 SSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVARWYANAKKVTPGWEEN 196

  Fly   202 CSGLEKLRQTMES 214
            ..|..:|:...::
  Fly   197 WKGAVELKGVFDA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 52/192 (27%)
GST_N_Delta_Epsilon 6..79 CDD:239343 23/69 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/116 (24%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 51/181 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/69 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.