DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstD2

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:208 Identity:57/208 - (27%)
Similarity:112/208 - (53%) Gaps:4/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAI 73
            ||.......|:.:|:.|.|.:::..:.:|..:|||.:.:|:.|||||::||||.....:.:|.||
  Fly     4 YYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68

  Fly    74 LIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHERKLT 138
            .::|.||:.:...|.|.:..:|..:...|.|:...|:...:.:.....|.|....|  ...:::.
  Fly    69 AVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSD--EDLKRIE 131

  Fly   139 EAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWF-TAMQQLDAYEAN 201
            .|:..::.:||..:::||.|||:||::|::|:||..:. |..|::..:.||: .|.:....::.|
  Fly   132 TAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDEN 196

  Fly   202 CSGLEKLRQTMES 214
            ..||..::...::
  Fly   197 WEGLMAMKALFDA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 54/192 (28%)
GST_N_Delta_Epsilon 6..79 CDD:239343 24/69 (35%)
GST_C_Delta_Epsilon 94..209 CDD:198287 29/116 (25%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 24/69 (35%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/117 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.