DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:188 Identity:41/188 - (21%)
Similarity:80/188 - (42%) Gaps:45/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGD-LVLTDSHAILIHLAEKFDEGGSL 87
            :|:.|   ..:|....|..:|.|.|    |...||.....: ..|::|:||...||.:...||  
  Fly    29 VKVAD---NFKFGETNKSAEFLKKF----PGGKVPAFETAEGQYLSESNAIAYLLANEQLRGG-- 84

  Fly    88 WPQEHAERMKVLNLLLFECSFLFRR--------DSDFMSATVRQGFANVDVAHHERKLT---EAY 141
                             :|.|:..:        |::.:.|:....|..:.:...::..|   ||.
  Fly    85 -----------------KCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAE 132

  Fly   142 IIMERY---LENSDFMAGPQLTLADLSIVTTLSTV--NLMFP--LSQFPRLRRWFTAM 192
            .::::.   |:::.|:||.::||||:.:.::|..:  .::.|  .|.|..:.|||..:
  Fly   133 AVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 41/188 (22%)
GST_N_Delta_Epsilon 6..79 CDD:239343 15/55 (27%)
GST_C_Delta_Epsilon 94..209 CDD:198287 23/117 (20%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 16/56 (29%)
GstA 5..187 CDD:223698 39/183 (21%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 21/101 (21%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.