DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstD9

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:203 Identity:64/203 - (31%)
Similarity:114/203 - (56%) Gaps:8/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAI 73
            ||...|.|.||.||..:.|.:::..:.|:|..||..:.:|:.:||||::||||.....:.:|.||
  Fly     5 YYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAI 69

  Fly    74 LIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDV---AHHER 135
            ||:||||:|:.|||:|::..:|..:...|.|:.|.|::   .::.....|.|.:|..   ..:.:
  Fly    70 LIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQ---SYVYYYYPQLFEDVKKPADPDNLK 131

  Fly   136 KLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWF-TAMQQLDAY 198
            |:.:|:.:....|:...:.|..:|||||.:::.|:||..:. :...::|.:.||: .|.:.:..:
  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGW 196

  Fly   199 EANCSGLE 206
            |.|..|.|
  Fly   197 EENWEGCE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 60/195 (31%)
GST_N_Delta_Epsilon 6..79 CDD:239343 28/69 (41%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/118 (24%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 28/69 (41%)
GstA 4..187 CDD:223698 59/184 (32%)
GST_C_Delta_Epsilon 89..207 CDD:198287 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.