DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstE14 and MARS1

DIOPT Version :9

Sequence 1:	NP_610855.1	Gene:	GstE14 / 36467	FlyBaseID:	FBgn0033817	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	NP_004981.2	Gene:	MARS1 / 4141	HGNCID:	6898	Length:	900	Species:	Homo sapiens

Alignment Length:	120	Identity:	27/120 - (22%)
Similarity:	47/120 - (39%)	Gaps:	30/120 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    82 DEGGSLWPQ-EHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHERKLTEAYIIME 145
            |:..:.|.: |..|....|:..|:......::..|.: .:||:...::|   |.         :.
Human    78 DDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVL-GSVRRALTHID---HS---------LS 129

  Fly   146 RYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQFP--------RLRRWFTAM 192
            |  :|..|:||...:|||:.:...|      :||.|.|        .|..||..:
Human   130 R--QNCPFLAGETESLADIVLWGAL------YPLLQDPAYLPEELSALHSWFQTL 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstE14	NP_610855.1	GstA	6..200	CDD:223698	27/120 (23%)
		GST_N_Delta_Epsilon	6..79	CDD:239343
		GST_C_Delta_Epsilon	94..209	CDD:198287	24/107 (22%)
MARS1	NP_004981.2	Thioredoxin_like	<27..68	CDD:294274
		GstA	<47..189	CDD:223698	27/120 (23%)
		GST_C_MetRS_N	77..179	CDD:198340	27/120 (23%)
		PRK12268	264..819	CDD:237029
		MetRS_core	265..633	CDD:173907
		'HIGH' region	273..283
		'KMSKS' region	593..597
		Anticodon_Ia_Met	642..771	CDD:153411
		MetRS_RNA	845..889	CDD:238475
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0625
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900