DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstE12

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:216 Identity:74/216 - (34%)
Similarity:119/216 - (55%) Gaps:9/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD 69
            ||.|||...|||.|:.|:..|.:.:|:|||.:||.|||....:||.|||||::|||:.|:..:.|
  Fly     3 KPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIID 67

  Fly    70 SHAILIHLAEKF-DEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGF--ANVDVA 131
            ||||..:|.||: .:...|:|:|..:|..|...|..:...||.|........:..|.  .::|..
  Fly    68 SHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKI 132

  Fly   132 HHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQ--FPRLRRWFTAMQQ 194
            .:.:|..|   |:|.:|::..::.|..||:||...|.|:::||...|:.:  ||::..|...:.:
  Fly   133 AYIQKCWE---ILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAE 194

  Fly   195 LDAY-EANCSGLEKLRQTMES 214
            |..| |.|..|.::|:...::
  Fly   195 LPYYQEVNGDGADELKSIFKA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 69/199 (35%)
GST_N_Delta_Epsilon 6..79 CDD:239343 36/72 (50%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/119 (26%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 36/72 (50%)
GstA 6..201 CDD:223698 68/197 (35%)
GST_C_Delta_Epsilon 92..210 CDD:198287 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.