DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstE8

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:226 Identity:69/226 - (30%)
Similarity:112/226 - (49%) Gaps:12/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD 69
            |.|||..|.|||||:..:.:..|.|..|...:|....|....:||..||||:||||......:.|
  Fly     3 KLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWD 67

  Fly    70 SHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLF----RRDSDFMSATVRQGFANVDV 130
            ||||..:|..|:.:..:|:|::..:|..|...|.||...:|    |..:..:.||   |...:..
  Fly    68 SHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFAT---GQTTIPK 129

  Fly   131 AHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLS--TVNLMFPLSQFPRLRRWFTAMQ 193
            ..:: .:.|.|..:|.:|...||:||.|||:||.|::|:::  .|.::....::..:..|...::
  Fly   130 ERYD-AVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIE 193

  Fly   194 QLDAYEANCSGLEKLRQTMESVGSFQFPSSS 224
            :|..||..|.  :..|..:..:..|.|..|:
  Fly   194 ELPYYEEACG--KGARDLVTLLKKFNFTFST 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 62/199 (31%)
GST_N_Delta_Epsilon 6..79 CDD:239343 30/72 (42%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/120 (26%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 60/195 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/72 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.