DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstE2

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:225 Identity:68/225 - (30%)
Similarity:118/225 - (52%) Gaps:26/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD 69
            |.:||..:.|||||:|.:.::.|::|.|.:.::|..|:.|:..||..||||:||.|.....::.|
  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD 68

  Fly    70 SHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHE 134
            ||||:.:|.:|:.....|:|::...|.:|...|.|:.|.||            ....||.:.:..
  Fly    69 SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILF------------MSLRNVSIPYFL 121

  Fly   135 RKLT-----------EAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQ--FPRLR 186
            |:::           :||..:|.:|.::.::.|.|||:|||....|.|::..:..|.:  :|::.
  Fly   122 RQVSLVPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVA 186

  Fly   187 RWFTAMQQLDAYEA-NCSGLEKLRQTMESV 215
            .||..:.:|..||. |..||:|....::.|
  Fly   187 AWFERLSKLPHYEEDNLRGLKKYINLLKPV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 61/206 (30%)
GST_N_Delta_Epsilon 6..79 CDD:239343 29/72 (40%)
GST_C_Delta_Epsilon 94..209 CDD:198287 34/128 (27%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 59/202 (29%)
GST_N_Delta_Epsilon 5..78 CDD:239343 29/72 (40%)
GST_C_Delta_Epsilon 94..209 CDD:198287 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.