DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GstE13

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:213 Identity:72/213 - (33%)
Similarity:120/213 - (56%) Gaps:12/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGD-LVLT 68
            ||.|||...|||.|:|:::.||:.:|:||:.|:..|.|...::|:.|||||.:|..|..| .|..
  Fly     3 KPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYV 67

  Fly    69 DSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHH 133
            |||||:..|..|:.....|:|::...|..:.:.:.:|...||:...|.::..:..|    :..::
  Fly    68 DSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGG----EGEYN 128

  Fly   134 ERKLT---EAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL--SQFPRLRRWFTAMQ 193
            .|.||   .||..:|.:|:...|:.|.:|::||:||.|||.|::|:.|:  .::|:.::|...|.
  Fly   129 PRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMD 193

  Fly   194 QL--DAYEANCSGLEKLR 209
            :|  |..|.|..|...|:
  Fly   194 KLLPDNEEINLKGARALQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 67/201 (33%)
GST_N_Delta_Epsilon 6..79 CDD:239343 33/73 (45%)
GST_C_Delta_Epsilon 94..209 CDD:198287 34/121 (28%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 33/73 (45%)
GST_C_Delta_Epsilon 92..211 CDD:198287 34/122 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.