DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and GSTT1

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:251 Identity:67/251 - (26%)
Similarity:110/251 - (43%) Gaps:51/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72
            ||.|..|.|.|:..:..|..||..|||.|:|.||:.....|..:||...||.|..||..||:|.|
Human     5 LYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVA 69

  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRR-------------------DSDFMS 118
            ||::|..|:......:||:...|.:|...|.::.:.|.|.                   ....::
Human    70 ILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLA 134

  Fly   119 ATVRQGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLSQ-- 181
            ||:    |.:||.        ..::.:::|:|..|:.||.::||||..:|     .||.|:..  
Human   135 ATL----AELDVT--------LQLLEDKFLQNKAFLTGPHISLADLVAIT-----ELMHPVGAGC 182

  Fly   182 -----FPRLRRWFTAMQQLDAYEANCSGLEKLRQTMESV-GSFQFPSSSAVVTEKV 231
                 .|:|..|   .|:::|    ..|.:..::..|.: .:..||.:...:.:|:
Human   183 QVFEGRPKLATW---RQRVEA----AVGEDLFQEAHEVILKAKDFPPADPTIKQKL 231

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 62/217 (29%)
GST_N_Delta_Epsilon 6..79 CDD:239343 31/70 (44%)
GST_C_Delta_Epsilon 94..209 CDD:198287 29/140 (21%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 31/72 (43%)