DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and Eef1g

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:214 Identity:49/214 - (22%)
Similarity:89/214 - (41%) Gaps:32/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGD--LVLTDSHAILIHLAEKFDEGGS 86
            |::|.......|....:..:|.:.|    |...||.. .||  ..:.:|:||..:::.:...|.:
  Rat    29 IRVLSAPPHFHFGQTNRTPEFLRKF----PAGKVPAF-EGDDGFCVFESNAIAYYVSNEELRGST 88

  Fly    87 LWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHERKLTE--------AYII 143
              |:..|:   |:..:.|       .|||.:.......|..:.:.||.::.||        ...:
  Rat    89 --PEAAAQ---VVQWVSF-------ADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGL 141

  Fly   144 MERYLENSDFMAGPQLTLADLSIVTTLSTV--NLMFP--LSQFPRLRRWFTAMQQLDAYEANCSG 204
            ::.:|:...|:.|.::||||:::|.||..:  .::.|  ...||...|||........:.| ..|
  Rat   142 LDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRA-ILG 205

  Fly   205 LEKLRQTMESVGSFQFPSS 223
            ..||.:.|....:.:|..|
  Rat   206 EVKLCEKMAQFDAKKFAES 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 42/189 (22%)
GST_N_Delta_Epsilon 6..79 CDD:239343 13/56 (23%)
GST_C_Delta_Epsilon 94..209 CDD:198287 29/126 (23%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 13/57 (23%)
maiA 5..187 CDD:273527 39/174 (22%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/132 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 2/4 (50%)
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.