DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and gst2

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:233 Identity:59/233 - (25%)
Similarity:98/233 - (42%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLV---HGDLVLTD 69
            ||.....|.....::.:|.|::..|..|.:..||||..|:.|||||...|||||   :.|..:.:
pombe     6 LYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNNDYTIWE 70

  Fly    70 SHAILIHLAEKFDEGGSL-WPQEHAERMKVLNLLLFECS-----------FLFRRDSDFMSATVR 122
            |.||||:||:|:|....: ...:..|..|::..|.|:.|           |.|......:||..|
pombe    71 SDAILIYLADKYDTDRKISLSFDDPEYYKLIQYLFFQASGQGVIWGQAGWFNFFHHEPVVSAVTR 135

  Fly   123 QGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMF---------- 177
                      :..::.....::|..|::.|::...:.|:||||.:.....:..:|          
pombe   136 ----------YRNEIKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKFSFKEE 190

  Fly   178 -PL----SQFPRLRRWFTAMQQLDAYEANCSGLEKLRQ 210
             |.    .:||:...|...:....|.:|....|.|.::
pombe   191 VPQLDFEKEFPKAYAWNQRLLARPAVKATFEELAKAKE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 56/221 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 29/73 (40%)
GST_C_Delta_Epsilon 94..209 CDD:198287 27/140 (19%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 31/77 (40%)
GstA 5..226 CDD:223698 58/229 (25%)
GST_C_Ure2p 96..219 CDD:198326 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.