DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and gst1

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:229 Identity:60/229 - (26%)
Similarity:108/229 - (47%) Gaps:27/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLV---HGDLVLTD 69
            |:.....|.....:..:|.||:..|.|:||..|.||...:.|||||...||||:   :.|..:.:
pombe     6 LWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWE 70

  Fly    70 SHAILIHLAEKFD-EGGSLWPQEHAERMKVLNLLLFECS---FLFRRDSDFMSATVRQGFANVDV 130
            |.||||:||:|:| |.....|::|.|..||:..|.|:.|   .::.:...|  :...|......:
pombe    71 SDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWF--SVYHQELVISAI 133

  Fly   131 AHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFP---------------LS 180
            ..:..::.....::|..|::.|::...:.|:||||.::..:.:.::|.               ..
pombe   134 TRYRNEIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEVPQLDFEK 198

  Fly   181 QFPRLRRWFTAMQQLDAYEANCSGLEKLRQTMES 214
            :|||...|.   |:|.|..|:.:..|:..:.:::
pombe   199 EFPRTYSWH---QRLLARPASKATFEERSKALDN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 58/213 (27%)
GST_N_Delta_Epsilon 6..79 CDD:239343 28/73 (38%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/132 (20%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 30/77 (39%)
GstA 5..218 CDD:223698 59/216 (27%)
GST_C_Ure2p 96..219 CDD:198326 25/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.