DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and gst-21

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001256002.1 Gene:gst-21 / 191412 WormBaseID:WBGene00001769 Length:231 Species:Caenorhabditis elegans


Alignment Length:234 Identity:56/234 - (23%)
Similarity:88/234 - (37%) Gaps:70/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILYYDER--SPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDF---LALNPQ----------HS 56
            :.|:|.|  :.|.|   ||..|..:.        |:..:...|.   |.:||:          ..
 Worm    18 LTYFDGRGLAEPAR---MLFHLGGVP--------FEDSRIPVDMKTGLIMNPELADVKKKAPFGK 71

  Fly    57 VPTLVHGDLVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDF---MS 118
            .|.|...|:.:..|.||..:||.:|...|.. |.|.|:....::    :|.   ..::.|   |.
 Worm    72 YPVLKIDDIEIAQSAAINRYLARQFGFAGKN-PIEEAQADSYID----QCQ---EYNTSFRACMY 128

  Fly   119 ATVRQGFANVDVAHHERKLTEAYI------------IMERYLENSDFMAGPQLTLADLSIVTTLS 171
            ||: ||....:|   ::...|.||            |:.|  ..|.|:.|..||.|||.|...|.
 Worm   129 ATL-QGKPEEEV---QKIREEVYIPAQNKFYEIFSDILNR--NKSGFLVGDSLTWADLVIADHLY 187

  Fly   172 TVNLMFPLSQFPRLRRWFTAMQQLDAYEANCSGLEKLRQ 210
            :::.|..|:             ..||:  .|..|:|.::
 Worm   188 SLDTMGMLT-------------HEDAW--RCETLKKFQE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 53/222 (24%)
GST_N_Delta_Epsilon 6..79 CDD:239343 20/86 (23%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/129 (23%)
gst-21NP_001256002.1 GST_N_Sigma_like 16..94 CDD:239337 20/86 (23%)
PTZ00057 18..231 CDD:173353 56/234 (24%)
GST_C_Sigma_like 104..213 CDD:198301 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.