Sequence 1: | NP_610855.1 | Gene: | GstE14 / 36467 | FlyBaseID: | FBgn0033817 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497118.1 | Gene: | gst-29 / 190225 | WormBaseID: | WBGene00001777 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 49/195 - (25%) |
---|---|---|---|
Similarity: | 84/195 - (43%) | Gaps: | 36/195 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YYDER--SPPVRSCLMLIKLLDIDV-ELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDS 70
Fly 71 HAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMS------ATVRQGFANVD 129
Fly 130 VAHHERKLT----EAYI-IMERYLE--NSDFMAGPQLTLADLSIVTTLSTVNLM--FPLSQFPRL 185
Fly 186 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE14 | NP_610855.1 | GstA | 6..200 | CDD:223698 | 49/195 (25%) |
GST_N_Delta_Epsilon | 6..79 | CDD:239343 | 18/72 (25%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 24/107 (22%) | ||
gst-29 | NP_497118.1 | GST_N_Sigma_like | 4..74 | CDD:239337 | 17/71 (24%) |
PTZ00057 | 6..209 | CDD:173353 | 49/195 (25%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 26/111 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |