DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and gst-29

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_497118.1 Gene:gst-29 / 190225 WormBaseID:WBGene00001777 Length:209 Species:Caenorhabditis elegans


Alignment Length:195 Identity:49/195 - (25%)
Similarity:84/195 - (43%) Gaps:36/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YYDER--SPPVRSCLMLIKLLDIDV-ELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDS 70
            |:|.|  :.|.|   :|..|..:.. :.||.:   |:...:......|...||.|......:..|
 Worm     8 YFDVRAYAEPAR---ILFHLAGVPFDDHRFPH---GDGTWEKLKDKTPFGQVPVLYVDGFEIPQS 66

  Fly    71 HAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMS------ATVRQGFANVD 129
            .||:.:||.||...|.. |:|.|....:::           :..||||      ...:.|.::|:
 Worm    67 AAIIRYLANKFGYAGKT-PEEQAWADAIVD-----------QFKDFMSLFREFKLAQKAGKSDVE 119

  Fly   130 VAHHERKLT----EAYI-IMERYLE--NSDFMAGPQLTLADLSIVTTLSTVNLM--FPLSQFPRL 185
            :|....::.    ::|. |:...||  .|.|:.|..||.||:.:|.:|:.:..:  |..|:.|:|
 Worm   120 IAKVASEVAIPARDSYFEIITNLLEKSKSGFLVGDGLTFADIVVVESLTNLEKVHFFDASEHPKL 184

  Fly   186  185
             Worm   185  184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 49/195 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 18/72 (25%)
GST_C_Delta_Epsilon 94..209 CDD:198287 24/107 (22%)
gst-29NP_497118.1 GST_N_Sigma_like 4..74 CDD:239337 17/71 (24%)
PTZ00057 6..209 CDD:173353 49/195 (25%)
GST_C_Sigma_like 85..191 CDD:198301 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.