DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and Gsto1

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:210 Identity:54/210 - (25%)
Similarity:86/210 - (40%) Gaps:37/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PKPI------LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVH 62
            |.|:      :|.....|..:..||::|...|..|:..:||....::   |...||...||.|.:
Mouse    16 PGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKNKPEW---FFEKNPLGLVPVLEN 77

  Fly    63 --GDLVLTDSHAILIHLAEKFDEGGSLWPQE-HAERMKVLNLLLFE------CSFL-FRRDSDFM 117
              |.|| |:|.....:|.|.:.| ..|:|.: :.:..:.:.|..|.      .||: .:|..|  
Mouse    78 SQGHLV-TESVITCEYLDEAYPE-KKLFPDDPYKKARQKMTLESFSKVPPLIASFVRSKRKED-- 138

  Fly   118 SATVRQGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSI---VTTLSTVNLMFPL 179
            |..:|:...|     ..:||.|.   |:.|   ..|:.|...::.|...   ...|..:.|...|
Mouse   139 SPNLREALEN-----EFKKLEEG---MDNY---KSFLGGDSPSMVDYLTWPWFQRLEALELKECL 192

  Fly   180 SQFPRLRRWFTAMQQ 194
            :..|:|:.|..||||
Mouse   193 AHTPKLKLWMAAMQQ 207

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 53/208 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 22/80 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 27/111 (24%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 22/81 (27%)
GstA 26..224 CDD:223698 52/200 (26%)