DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and Gstt2

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:235 Identity:59/235 - (25%)
Similarity:100/235 - (42%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD--- 69
            ||.|..|.|.|:..:..|...|..:.|.|::.||:...:.|..:|..:.||.|..|..|||:   
Mouse     5 LYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPS 69

  Fly    70 ----SHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDV 130
                |.||||:|:.|:......:|.:...|.:|...|.:....:.......:...|......|.|
Mouse    70 SMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQV 134

  Fly   131 AHH--ERKLTEAYIIM----ERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLS-------QF 182
            ...  ||......:::    :::|.:..|:.|.|:|||||     :|...||.|::       ..
Mouse   135 PQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADL-----MSLEELMQPVALGYNLFEGR 194

  Fly   183 PRLRRWFTAMQQLDAY-------EANCSGLEKLRQTMESV 215
            |:|..|   .::::|:       ||:.:.|..|.|..:.:
Mouse   195 PQLTAW---RERVEAFLGAELCQEAHSTILSILGQAAKKM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 54/218 (25%)
GST_N_Delta_Epsilon 6..79 CDD:239343 27/77 (35%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/134 (21%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 27/79 (34%)
GST_C_Theta 98..223 CDD:198292 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.