DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and Gstt1

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:251 Identity:63/251 - (25%)
Similarity:111/251 - (44%) Gaps:51/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72
            ||.|..|.|.|:..:..|..:|..::..|.|.|||.....|..:||...||.::.|...|.:|.|
Mouse     5 LYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVA 69

  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRR-------------------DSDFMS 118
            ||::||.|:......:||:...|.:|...|.::.:.|.|.                   ..:.::
Mouse    70 ILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQIPPETLA 134

  Fly   119 ATVRQGFANVDVAHHERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPL---- 179
            ||:    |.:||        ...::.:::|::.||:.||.::||||..:|     .||.|:    
Mouse   135 ATL----AELDV--------NLQVLEDKFLQDKDFLVGPHISLADLVAIT-----ELMHPVGGGC 182

  Fly   180 ---SQFPRLRRWFTAMQQLDAYEANCSGLEKLRQTMESVGSFQ-FPSSSAVVTEKV 231
               ...|||..|:   |:::|    ..|.:..|:..|.:...: .|.:..::.:|:
Mouse   183 PVFEGHPRLAAWY---QRVEA----AVGKDLFREAHEVILKVKDCPPADLIIKQKL 231

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 58/217 (27%)
GST_N_Delta_Epsilon 6..79 CDD:239343 25/70 (36%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/140 (21%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 60/230 (26%)
GST_N_Theta 3..78 CDD:239348 26/72 (36%)