DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE14 and C02D5.4

DIOPT Version :9

Sequence 1:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001254962.1 Gene:C02D5.4 / 13190517 WormBaseID:WBGene00043097 Length:254 Species:Caenorhabditis elegans


Alignment Length:224 Identity:53/224 - (23%)
Similarity:81/224 - (36%) Gaps:57/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKLLDIDVELRFVNLFKGEQ----FQKDFLALNPQHSVPTLVH--GDLVLTDSHAILIHLAEKFD 82
            :|.:..||    :|:...|:    |.|.:     :..||||.|  |...:.:|..|..:|.:.:.
 Worm    47 VKNIPSDV----INVHLQEKPDWYFSKHY-----KGQVPTLEHDEGKKHVIESAVIPEYLDDIYP 102

  Fly    83 EGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHERKLTE-------- 139
            |...| |.:..|:::...||            |.:|..|...|..|..|.....|.|        
 Worm   103 ETRIL-PTDPYEKVQQKLLL------------DRISGQVSPAFYGVVQAVKNPDLREEKFADIKK 154

  Fly   140 AYIIMERYLENSDFMAG------------PQLTLA--DLSIVTTLSTVNLMFPLSQFPRLRRWFT 190
            ||...|:.| ..||.:|            |.:..|  ...||.........||...:|||.:|:.
 Worm   155 AYDNAEQLL-TGDFYSGTSKPGFVDYLLYPNIQRAYWAAHIVPDFPLEAESFPGPNYPRLSKWYK 218

  Fly   191 AMQQLDAYEANCSGLEKLRQTMESVGSFQ 219
            |::.:....|      ..:.|...||.|:
 Worm   219 ALESIPEVAA------ASQPTENGVGFFK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE14NP_610855.1 GstA 6..200 CDD:223698 48/203 (24%)
GST_N_Delta_Epsilon 6..79 CDD:239343 16/60 (27%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/136 (22%)
C02D5.4NP_001254962.1 Thioredoxin_like 8..98 CDD:294274 15/59 (25%)
GstA 29..229 CDD:223698 49/210 (23%)
GST_C_family 112..243 CDD:295467 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.