DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and AKR2

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_014677.1 Gene:AKR2 / 854199 SGDID:S000005560 Length:749 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:54/310 - (17%)
Similarity:116/310 - (37%) Gaps:95/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WDRV--------KPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAI----------------- 46
            :||:        |..|.:.|..||  :.|:.:.||:.:::|:..:.||                 
Yeast   281 YDRLGNQKDKLFKKSSHAQFTIFL--SPFLLMVYIYLISLVLSPVLAIMLSLLVTVVMVNTLKKF 343

  Fly    47 ---------------------GGIWYT------LLWLASL--------------FLIFNITSNML 70
                                 .|::.:      .:|...|              ||:.:..:.:|
Yeast   344 VLPCLPRKNTYKVSLTRTPFFSGLFLSTFCFLIYIWTKKLYPYSVSDYTMKNVQFLVTSFLTVVL 408

  Fly    71 ---------ACMLVDTSIR--KELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRD 124
                     .|:..|.|:.  :|.:|..:|..:..|.:.|.:.....|.||.:.......|.:.|
Yeast   409 FLRLVRSDPGCLKTDDSLTSIQETIKQLIDLGKFDRENFCVETLERKPLRSKYSFFSGALVARYD 473

  Fly   125 HHCRFTCCCIGHHNYRYFFYYLV------YMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFA 183
            |:|.:....:|..|::.|.::.|      ::.:....|...::.|::. .::.|.|.:.|..   
Yeast   474 HYCPWIYNDVGLKNHKLFVFFAVTVQYHMFLFMWLCLAYFKKTNYIYE-QVEEYARCALLKN--- 534

  Fly   184 PVVSLMLSPSWE--SFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRE 231
              .:|....:::  :|:|.|: :::....:.::|:|..:.|.| |..|.|
Yeast   535 --ETLCKGSNYDPSTFFLFIW-ISVNFIWLGAMLIVQFFQILK-GITTPE 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 28/141 (20%)
AKR2NP_014677.1 ANKYR 1..195 CDD:223738
ANK repeat 54..81 CDD:293786
ANK repeat 83..115 CDD:293786
ANK repeat 117..148 CDD:293786
ANK repeat 189..220 CDD:293786
Ank_4 190..243 CDD:372654
ANK repeat 222..247 CDD:293786
COG5273 340..711 CDD:227598 41/249 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.