DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and PFA5

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_010747.1 Gene:PFA5 / 852070 SGDID:S000002867 Length:374 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:68/309 - (22%)
Similarity:114/309 - (36%) Gaps:101/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RVKPRSISDFACFLLVAV-FVPVTYIFHVTIVMPELFAIGGIWYTLLWL--------ASLFLIFN 64
            |::.:|:|   ..|:.|| |:.|..||              ||..::.|        .:.|||..
Yeast    46 RLRQKSVS---VGLICAVCFLDVVVIF--------------IWLQIVILVGPGTQPHVAPFLILP 93

  Fly    65 I-----TSNMLACMLVDTSIRKELLKPP----LDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCV 120
            |     |||...    :||:..:.:.||    .|......|  |.:||:|...|:.|......|:
Yeast    94 IASEEKTSNTSQ----NTSVEYDAVVPPKCYQSDPHGYPIW--CSECQSLKMERTHHSSELGHCI 152

  Fly   121 LKRDHHCRFTCCCIGHHNYRYFFYYLVY----MIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTI 181
            .:.||:|.:....||..|||.|..:..|    ::|..::..:...|...|.|             
Yeast   153 PRFDHYCMWIGTVIGRDNYRLFVQFAAYFSTLLLIMWVSICVYIRIITQHNH------------- 204

  Fly   182 FAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLL---VFHWSIFKSG------SVTRERGTRK- 236
                   ..||:..:..:......:||:.:::.||   :|:.|..|:.      |..::.|||| 
Yeast   205 -------NYSPNLNANIISTLVFAILGWLLTASLLASSIFYMSQNKTSLEAIIDSKRKKFGTRKI 262

  Fly   237 ---------------YDR----------GLRGNLEMVLGKRMHLTWLSP 260
                           :||          .:..|::..:|..: |.|:.|
Yeast   263 FCYYSEANKLRFVVEFDRSEFHSFWDKKSILANIKDFMGSNI-LMWIIP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 31/145 (21%)
PFA5NP_010747.1 COG5273 9..335 CDD:227598 68/309 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.