DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and SWF1

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_010411.1 Gene:SWF1 / 851704 SGDID:S000002533 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:52/226 - (23%)
Similarity:89/226 - (39%) Gaps:77/226 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IWYTLLWLASLFLIFNITSNMLACMLVDTSIRKEL------------LKPP--------LDAAQL 93
            ::||.::   |:|::...      |.|:::|:.||            :.||        :..|:.
Yeast    56 LFYTSIY---LYLVYTYH------MRVESTIKNELFLLERILIVPIIILPPVALGILAMVSRAED 111

  Fly    94 ARWH-------------------SCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNY 139
            ::.|                   .|..|:.:.|.||.||.:||.|||..||||.:...|||..||
Yeast   112 SKDHKSGSTEEYPYDYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNY 176

  Fly   140 RYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDL 204
            ..|:.:|:..|. |:..|.:.   ||::.|:                      |..:....:..|
Yeast   177 LQFYLFLISNIF-SMCYAFLR---LWYISLN----------------------STSTLPRAVLTL 215

  Fly   205 TLLGFAISSLLLVFHW---SIFKSGSVTRER 232
            |:|....:.:..:|.:   :|.|.|..|.|:
Yeast   216 TILCGCFTIICAIFTYLQLAIVKEGMTTNEQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 38/135 (28%)
SWF1NP_010411.1 COG5273 22..336 CDD:227598 52/226 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346344
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.