DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and ZDHHC16

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006718084.1 Gene:ZDHHC16 / 84287 HGNCID:20714 Length:384 Species:Homo sapiens


Alignment Length:339 Identity:82/339 - (24%)
Similarity:120/339 - (35%) Gaps:119/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AVFVPVTYI-------FHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLAC---------- 72
            |.|.||.::       |.|..|:..:...|.| ..:.:|..|.||....|....|          
Human    63 AAFEPVYWLVDNVIRWFGVVFVVLVIVLTGSI-VAIAYLCVLPLILRTYSVPRLCWHFFYSHWNL 126

  Fly    73 MLVDTSIRKELLKPPLDAAQ----LARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCC 133
            :|:.....:.:..||....|    :|....|:.|....|.|:.||.:||.||||.||||.:...|
Human   127 ILIVFHYYQAITTPPGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNC 191

  Fly   134 IGHHNYRYFFYYLVYMIIGSL------------AAAIMES------------------------- 161
            :||:|:||||.:..:|.:|.:            |.|.:|.                         
Human   192 VGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTF 256

  Fly   162 -----------IYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLL 215
                       :|||.|                    ..|.||:         |:.:..|:.: |
Human   257 SFRERMTHKSLVYLWFL--------------------CSLRPSF---------LSSVALALGA-L 291

  Fly   216 LVFHWSIFKSGSVTRERGTRK----------------YDRGLRGNLEMVLGKRMHLTWLSPFL-- 262
            .|:|..:...|..:.||...|                |:.|...|.::.||......||:..|  
Human   292 TVWHAVLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLP 356

  Fly   263 RSDLPH-DGMNWEP 275
            .|.||| :||:|||
Human   357 SSHLPHGNGMSWEP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 42/180 (23%)
ZDHHC16XP_006718084.1 zf-DHHC 155..312 CDD:279823 44/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.