DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and AT5G50020

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001190503.1 Gene:AT5G50020 / 835066 AraportID:AT5G50020 Length:444 Species:Arabidopsis thaliana


Alignment Length:305 Identity:75/305 - (24%)
Similarity:114/305 - (37%) Gaps:75/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLLVAVFVPVTY--IFHVTIVMPEL--------FAIGGIWYTLLWLASLFLIFNITSNMLAC--- 72
            |..:.:..||.:  :|..|.:..||        |.:.|:.:|:..|..|||.......::..   
plant    62 FTFLLIITPVCFFSVFVATHLRRELLPNNAGHVFLVAGVLFTVFVLILLFLTSARDPGIVPRNSH 126

  Fly    73 -----MLVDTSIRKELLKPPLDAAQLARWHS------------CQDCQTLVPPRSWHCEVCNVCV 120
                 :..||::..:..:.|  ..|:.|...            |..|....|||..||.:||.||
plant   127 PPEEELCYDTTVSSDGRQTP--TVQIPRTKEVMVYGVSVRVKYCDTCMLYRPPRCSHCSICNNCV 189

  Fly   121 LKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHL---HLDIYWRWSTLFTIF 182
            .:.||||.:...|||..||||||.::....|..:....|.::|:..|   |....||        
plant   190 ERFDHHCPWVGQCIGVRNYRYFFMFVSSATILCIYIFSMSALYIKVLMDNHQGTVWR-------- 246

  Fly   183 APVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVT----RERGTRK---YDRG 240
                ::..|| | :..|:||....|.|.  ..|..||..:..:...|    |.|...:   |:||
plant   247 ----AMRESP-W-AVMLMIYCFISLWFV--GGLTGFHLYLISTNQTTYENFRYRSDNRINVYNRG 303

  Fly   241 LRGN-LEMVLGKRMHLTWLSP-------FLRSDLPHD---GMNWE 274
            ...| .|....|      :.|       |::.:.|.:   ...||
plant   304 CSNNFFETFCSK------VKPSRNDFRAFIKEEPPRNITLATTWE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 44/139 (32%)
AT5G50020NP_001190503.1 Cation_efflux <23..114 CDD:279834 14/51 (27%)
zf-DHHC 166..291 CDD:279823 43/140 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.