DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and AT5G05070

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_196126.2 Gene:AT5G05070 / 830389 AraportID:AT5G05070 Length:413 Species:Arabidopsis thaliana


Alignment Length:185 Identity:48/185 - (25%)
Similarity:79/185 - (42%) Gaps:40/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYL-------VYMIIGSLAA 156
            |..|....|||:.||.:||.||.:.||||.:...||...||.:|..::       :|:.:.|...
plant   173 CDTCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCIARRNYPFFICFISSSTLLCIYVFVFSWIN 237

  Fly   157 AIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWS 221
            .|.:...||.             |:...:||::         |::|....:.|.  ..|.:||:.
plant   238 LIRQPGKLWR-------------TMSDDIVSVI---------LIVYTFVAVWFV--GGLTIFHFY 278

  Fly   222 IFKSGSVTRERGTRKYD-------RGLRGNLEMVLGKRMHLTWLSPFLRSDLPHD 269
            :..:...|.|....:||       |||..|::.||..::..:.|.  ||:.:|.:
plant   279 LMSTNQTTYENFRYRYDKKENPYKRGLLKNVKEVLFAKIPPSQLD--LRAMVPEE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 35/139 (25%)
AT5G05070NP_196126.2 zf-DHHC 171..292 CDD:279823 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.