DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4676 and AT4G24630

DIOPT Version :9

Sequence 1:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_194194.2 Gene:AT4G24630 / 828565 AraportID:AT4G24630 Length:407 Species:Arabidopsis thaliana


Alignment Length:278 Identity:72/278 - (25%)
Similarity:110/278 - (39%) Gaps:74/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LVAVFVPVTYIFHVTIV--MPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVDTSIRKELL- 84
            |:.:.|||. :|.|.:.  :...|:.....|.::.:|.||.|:      :..:|..||.|...: 
plant    34 LLLIIVPVV-LFCVFVARHLRHEFSPYNAGYAIMVVAILFTIY------VLILLFFTSARDPGIV 91

  Fly    85 ----KPPLD----------------AAQLARWHS------------CQDCQTLVPPRSWHCEVCN 117
                .||.:                :.|:.|...            |..|....|||..||.:||
plant    92 PRNSHPPEEDLRYETTVSADGRQTPSVQIPRTKEVIVNGVSVRVKYCDTCMLYRPPRCSHCSICN 156

  Fly   118 VCVLKRDHHCRFTCCCIGHHNYRYFFYY-----LVYMIIGSLAAAIMESIYLWHLHLDIYWRWST 177
            .||.:.||||.:...|||..||||||.:     |:.:.|.|::|..:: |.:.|....: ||   
plant   157 NCVERFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCIYIFSMSAVYIK-ILMDHQQATV-WR--- 216

  Fly   178 LFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRK------ 236
                     ::..|| | :..|:||....|.|.  ..|..||..:..:...|.|:...:      
plant   217 ---------AMKESP-W-AVVLMIYCFIALWFV--GGLTAFHLYLISTNQTTYEKLRYRSSHSRS 268

  Fly   237 --YDRGLRGN-LEMVLGK 251
              |:||...| ||:...|
plant   269 IVYNRGCPNNFLEVFCSK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 44/137 (32%)
AT4G24630NP_194194.2 zf-DHHC 136..261 CDD:279823 45/142 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.